DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG4613

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:239 Identity:71/239 - (29%)
Similarity:119/239 - (49%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPI- 182
            ||:..::  |.:....||.||....|:||......|....:.||..:.|.|       |..:.: 
  Fly   149 PWIAQII--RGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRS-------STHLGVT 204

  Fly   183 RSIV---RHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSA-PKNFDFSRCIFTGWGKNSFD 243
            ||:.   .|.|::..:..:::||:.|.:.:.....:.|.|:||. .:||||.:.|..|||. |.:
  Fly   205 RSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGL-SQE 268

  Fly   244 DPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFE--LDNSLMCAG--GEPGKDSCEGDGGSPLAC 304
            ..|..:||:::.:|::....|.       ...:.  :.:::||||  ...|:|:|:||.|.||  
  Fly   269 GGSTSSVLQEVVVPIITNAQCR-------ATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPL-- 324

  Fly   305 AIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTT 348
            .::|  :.:.|||:|:||..|..|..|.|||.|:..:|||.:.|
  Fly   325 IVRD--RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNT 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/233 (29%)
Tryp_SPc 113..344 CDD:238113 68/233 (29%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 68/233 (29%)
Tryp_SPc 137..362 CDD:238113 68/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.