DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG10663

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:262 Identity:77/262 - (29%)
Similarity:125/262 - (47%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGFVNS----KGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTEN 153
            ||.|.|    :.::...:......|::.|.||.||:|: |......||.||||..|:||......
  Fly   489 CGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILN-RFKEAFCGGTLIAPRWVLTAAHCVRK 552

  Fly   154 MTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPI 218
            :    |.||.||.:.:  .|....:.:.:.....||.|:.....::|||:.|.:::.::..|...
  Fly   553 V----LFVRIGEHNLN--YEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYS 611

  Fly   219 CMP----SAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELD 279
            |:|    :.|||.|   |...||||....|.:..:||.|.::|::..:.|.   ::||  |:.:.
  Fly   612 CLPQPFQALPKNVD---CTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCR---KVYY--DYTIT 668

  Fly   280 NSLMCAGGEPGK-DSCEGDGGSPLACAIKDNPQR-YELAGIVNFGVDCGLPGVPAVYTNVANVIE 342
            .::.|||.:.|. |:|.||.|.||.|.....|.. :.:.||.:||..|.......:|..|.|.::
  Fly   669 KNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVD 733

  Fly   343 WI 344
            |:
  Fly   734 WV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/236 (31%)
Tryp_SPc 113..344 CDD:238113 72/236 (31%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 72/243 (30%)
Tryp_SPc 507..735 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.