DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG11529

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:237 Identity:58/237 - (24%)
Similarity:105/237 - (44%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDAR--TSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP 181
            |:.|.|:..:  ....:.||.|:....::||...|..:|         .:|....|:.:...:|.
  Fly    42 PYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVT---------HYDVYLGTKSVEDTEVS 97

  Fly   182 ----IRS--IVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFS--RCIFTGWG 238
                :||  .:.|..||.|..||::|||.|.:.:..:..|.|..:||..::..|:  ..:.:|||
  Fly    98 GGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWG 162

  Fly   239 KNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLA 303
              :..:.:..:.::...|.|:....|.|:..:       :.:.::||.|...:..|.||.|.|| 
  Fly   163 --AMVEMTNSDSMQYTELKVISNAECAQEYDV-------VTSGVICAKGLKDETVCTGDSGGPL- 217

  Fly   304 CAIKDNPQRYELAGIVNFGVDCGL-PGVPAVYTNVANVIEWI 344
             .:||.   ..:.||.:||...|. ..:|..:|.|.:.::||
  Fly   218 -VLKDT---QIVVGITSFGPADGCETNIPGGFTRVTHYLDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 56/235 (24%)
Tryp_SPc 113..344 CDD:238113 56/235 (24%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 58/237 (24%)
Tryp_SPc 37..255 CDD:214473 56/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.