DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG8329

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:239 Identity:60/239 - (25%)
Similarity:100/239 - (41%) Gaps:36/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGE---WDFSTKTEQ 174
            |.|.:.|:.|.|  ...:..|.||::|..:.|:||   ...:|...:.:..|.   |:     .|
  Fly    41 AYEGKAPYAVGL--RMNNGAVGGGSVIGNNWVLTA---AHCLTTDSVTIHYGSNRAWN-----GQ 95

  Fly   175 LPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTS-SRHINPICMP---SAPKNFDFSRCIFT 235
            |... |...:..||||:. .:..:::.|:  |....| :..||.:.:|   ...:.|:...|:..
  Fly    96 LQHT-VNKNNFFRHPGYP-NSAGHDIGLI--RTPYVSFTNLINKVSLPKFSQKGERFENWWCVAC 156

  Fly   236 GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGS 300
            |||  ...:....:.|:.:.:.|:....|.:.    ||:....|   ||.....||..|.||.|.
  Fly   157 GWG--GMANGGLADWLQCMDVQVISNGECARS----YGSVASTD---MCTRATDGKSVCGGDSGG 212

  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
              |....|||.:   .|::.| ...|....|:.||.|::.::||
  Fly   213 --ALVTHDNPIQ---VGVITF-ASIGCKSGPSGYTRVSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 58/237 (24%)
Tryp_SPc 113..344 CDD:238113 58/237 (24%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 60/239 (25%)
Tryp_SPc 35..250 CDD:214473 58/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.