DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG16998

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:229 Identity:69/229 - (30%)
Similarity:102/229 - (44%) Gaps:26/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTE---QLPSVDV 180
            ||:.::  ....:|....|||....::||....:  ......||||    ||.|:   |..:|  
  Fly    37 PWLASI--TVHGNYSCSSALITSLWLVTAGHCVQ--YPDSYSVRAG----STFTDGGGQRRNV-- 91

  Fly   181 PIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDP 245
              .|::.||.|||....|::||:.|.:|.|...:|..:.:|....|......:..|||.....|.
  Fly    92 --VSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRTLLVAGWGNPDATDS 154

  Fly   246 SYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNP 310
            .....|:...:.|:.:|.|:   |||......:.:.::||.| .|:|.|.||.|:||.       
  Fly   155 ESEPRLRGTVVKVINQRLCQ---RLYSHLHRPITDDMVCAAG-AGRDHCYGDSGAPLV------- 208

  Fly   311 QRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            .|....|||:|...|..|..|.|||.:||.:.||
  Fly   209 HRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/227 (30%)
Tryp_SPc 113..344 CDD:238113 67/227 (30%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 67/227 (30%)
Tryp_SPc 25..242 CDD:238113 67/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.