DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG10469

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:255 Identity:69/255 - (27%)
Similarity:126/255 - (49%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 TFSFREEDTGLAQEAEVPWMVALL----DARTSSYVAGGALIAPHVVITARQRTENMTAS--QLV 160
            |.|.|..:...|:..::|:.|.||    .::....:.||.:::...:|||....::..::  :::
  Fly    19 TGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVL 83

  Fly   161 VRAGEWDFSTKTEQLPSVDVPI-RS-IVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSA 223
            :..|      |.:.....::.: || .:.|..|:.:...|::||:.|.:.||.:::|.|..:|||
  Fly    84 IHVG------KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSA 142

  Fly   224 PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFE--LDNSLMCAG 286
            .|.:...:.|.:|||..:...||  .||:.|..|::..:.||:|.....|...:  :.|..:|..
  Fly   143 KKTYTGRKAIISGWGLTTKQLPS--QVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICID 205

  Fly   287 GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVD--CGLPGVPAVYTNVANVIEWI 344
            .:.|. .|.||.|.|:   :.|:..| .|.|||:.|.|  |.|. :|.|.|.|::.::||
  Fly   206 SKKGL-PCRGDSGGPM---VLDDGSR-TLVGIVSHGFDGECKLK-LPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/242 (26%)
Tryp_SPc 113..344 CDD:238113 64/242 (26%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 65/249 (26%)
Tryp_SPc 24..260 CDD:238113 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.