DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG10472

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:108/247 - (43%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TG--LAQEAEVPWMVALLDARTSSYVAGGA------LIAPHVVITARQRTENMTASQLVVRAGEW 166
            ||  :|:..:.|:.|.||     .|:.|||      :|:...:|||...|:::|....|......
  Fly    48 TGGQIAEPNQFPYQVGLL-----LYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHD 107

  Fly   167 DFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP---SAPKNFD 228
            ..:.|.|....:.|..::::.|..:..|...|:::|:.|...:..:::|.|..:|   .:...:.
  Fly   108 RTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYG 172

  Fly   229 FSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDS 293
            ....|.:||||.|.......::|:..::|::....|..   .|:|   .:..|.:|.....|..:
  Fly   173 GENAIASGWGKISDSATGATDILQYATVPIMNNSGCSP---WYFG---LVAASNICIKTTGGIST 231

  Fly   294 CEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLP-GVPAVYTNVANVIEWI 344
            |.||.|.||......|    .|.|..:||:..|.. |.|.|:|.:...::||
  Fly   232 CNGDSGGPLVLDDGSN----TLIGATSFGIALGCEVGWPGVFTRITYYLDWI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 57/240 (24%)
Tryp_SPc 113..344 CDD:238113 57/240 (24%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 59/245 (24%)
Tryp_SPc 47..282 CDD:238113 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.