DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG6592

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:115/233 - (49%) Gaps:15/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSS-YVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPI 182
            |:.|.:|..|... |..||:||:...||||....:....:.:.:.|.|...:.:..|: .:.||.
  Fly   135 PYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQV-RLMVPS 198

  Fly   183 RSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAP---KNFDFSRCIFTGWGKNSFDD 244
            .:...:|.:|.:...:::|:|.|..:::.:..|:||.:|...   ::|.....|.:|||:.:...
  Fly   199 ENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGV 263

  Fly   245 PSYMNVLKKISLPVVQRRTCEQQLRL-YYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKD 308
            .:..|||:.:.|.::..|||:....| |.|.:       :|..|...:.:|.||.|.||....:.
  Fly   264 HAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN-------ICTSGRNARSTCNGDSGGPLVLQRRH 321

  Fly   309 NPQRYELAGIVNFGVDCGLP-GVPAVYTNVANVIEWIT 345
            :.:|. |.||.:||...|.. |.||.:|.||:.::||:
  Fly   322 SKKRV-LVGITSFGSIYGCDRGYPAAFTKVASYLDWIS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 63/230 (27%)
Tryp_SPc 113..344 CDD:238113 63/230 (27%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 63/230 (27%)
Tryp_SPc 123..359 CDD:238113 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.