DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:310 Identity:77/310 - (24%)
Similarity:129/310 - (41%) Gaps:50/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KVKIEFRMAMTYRNLGCVSTAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGL 112
            ||.:.|.:|:...:.|.:      |:.:.| .||.:  ..:|:.:....|.|..|          
  Fly     2 KVLVVFALALATASAGLL------PQQVPI-HPRDL--PAVTNIEGRITNGKTAT---------- 47

  Fly   113 AQEAEVPWMVALLDARTS-SYVAGGALIAPHVVITARQRTENMTASQL----VVRAGEWDFSTKT 172
              ..:.|:.|.|..|.|| |:..||::|....|:||...|...:|..:    .||.     |.:.
  Fly    48 --SGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRT-----SAQL 105

  Fly   173 EQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAP---KNFDFSRCIF 234
            .|..|.|    :.|:|..:|.....|:::|: ...::..:..||.:.:|:..   ..:...:.|.
  Fly   106 VQTVSAD----NFVQHASYNSIVLRNDISLI-KTPTVAFTALINKVELPAIAGTYSTYTGQQAIA 165

  Fly   235 TGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGG 299
            :||||.|....|..|.|:.....||....|:..    ||: ....|:::|........:|.||.|
  Fly   166 SGWGKTSDSATSVANTLQYEVFEVVSVSQCQNT----YGS-LVATNNVICVATPNKVSTCNGDSG 225

  Fly   300 SPLACAIKDNPQRYELAGIVNFGVDCGL-PGVPAVYTNVANVIEWITLTT 348
            .||. .:.|:    :|.|:.:|....|. .|.||.:|.|.:.::||...|
  Fly   226 GPLV-LVSDS----KLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIKTNT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 61/239 (26%)
Tryp_SPc 113..344 CDD:238113 61/239 (26%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 64/258 (25%)
Tryp_SPc 40..269 CDD:238113 66/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.