DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:112/243 - (46%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVAL---LDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQ 174
            |...:.|:.|.|   |.|.:|:: .||:||....|:||...|:.:.:..:.:.|.....:..|..
  Fly    44 AAVGQFPYQVGLSLKLSALSSAW-CGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHT 107

  Fly   175 LPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF---SRCIFTG 236
            :.|.|     |:.|.|:|..|..|:::|:.:..:.:||| |:.:.:||...::..   ...:.:|
  Fly   108 VSSSD-----IIIHSGWNSANLRNDISLIKIPATSSSSR-ISAVKLPSISNSYSTFVGDVAVASG 166

  Fly   237 WGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSP 301
            ||:.|.........|:.:.|.|:....|.|.    ||.....|::| |......|.:|.||.|.|
  Fly   167 WGRTSDTSSGVATNLQYVDLTVITNTKCAQT----YGTSVVTDSTL-CVATTDAKSTCNGDSGGP 226

  Fly   302 LACAIKDNPQRYELAGIVNFGVDCGL-PGVPAVYTNVANVIEWITLTT 348
            |  .:|.:.   |..|:.:||...|. .|.||.:|.|.:.::||...|
  Fly   227 L--VLKSSS---EQIGLTSFGASAGCEKGYPAAFTRVTSYLDWIKTNT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/237 (27%)
Tryp_SPc 113..344 CDD:238113 64/237 (27%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 64/237 (27%)
Tryp_SPc 38..268 CDD:238113 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.