DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG1299

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:373 Identity:101/373 - (27%)
Similarity:166/373 - (44%) Gaps:86/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QVQAQGQNAELNQSCGASNEHQCVPRHMCKVKIEFRMAMTYRNLGCVSTAICC------------ 71
            :::::.|:|.......|||.       :|:.|               .|.:||            
  Fly   186 ELRSRSQDATFANFLRASNA-------VCQNK---------------GTQVCCPTGQGITNTTPA 228

  Fly    72 PKNLIIKE----PRLIINEPITDPQCGFVNSKGVTFSFREEDTG--LAQEAEVPWMVALL---DA 127
            |..::.|.    ||.::|   .:..|      |.|..:.::..|  ::::...|| :|||   |.
  Fly   229 PSQIVPKNTDEIPRRLLN---VEEGC------GSTVGYFKKIVGGEVSRKGAWPW-IALLGYDDP 283

  Fly   128 RTSSYVAGGALIAPHVVITA----RQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRH 188
            ..|.:..||.||....|:||    ||..:       .||.||.|.||.|| ...||:.|...|.|
  Fly   284 SGSPFKCGGTLITARHVLTAAHCIRQDLQ-------FVRLGEHDLSTDTE-TGHVDINIARYVSH 340

  Fly   189 PGFNLENGANNVALVFLRRSLTSSRHINPICMPSA----PKNFDFSRCIFTGWGKNSFDDPSYMN 249
            |.:|..||.:::|:::|.|::..:..|.|||:|..    .|::........|||| :.:......
  Fly   341 PDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGK-TMEGGESAQ 404

  Fly   250 VLKKISLPVVQRRTCEQQL---RLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIKDNP 310
            ||.::.:|:...:.|.|..   :.|:..| :.|.:::|||. ..|||:|:||.|.||..     |
  Fly   405 VLNELQIPIYDNKVCVQSYAKEKRYFSAD-QFDKAVLCAGVLSGGKDTCQGDSGGPLML-----P 463

  Fly   311 QRYE------LAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMP 352
            :.|:      |.|:|::|:.|..|.||.||::....::||.....:.|
  Fly   464 EPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQVQDTP 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 79/251 (31%)
Tryp_SPc 113..344 CDD:238113 79/251 (31%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 8/51 (16%)
Tryp_SPc 260..503 CDD:214473 80/258 (31%)
Tryp_SPc 261..503 CDD:238113 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.