DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG14990

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:284 Identity:118/284 - (41%)
Similarity:164/284 - (57%) Gaps:11/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EPITDPQCGFVNSKGVTFSFR-EEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQ 149
            :|..:..||..|..|:..:.: .:|  .:...:.||:|||..  ...|...|:||||.||:||..
  Fly    41 QPDPNQVCGMSNPNGLVANVKVPKD--YSTPGQFPWVVALFS--QGKYFGAGSLIAPEVVLTAAS 101

  Fly   150 RTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRH 214
            .....|.:::|||||||:...::|.|||.|.|:..:|:|..|:...||||:||:||........|
  Fly   102 IVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSH 166

  Fly   215 INPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLR-LYYGNDFEL 278
            |..||:||..::||..||:.|||||.:|:|.:|.|:.|||.||::.|..|:.||| ...|..|:|
  Fly   167 IRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDL 231

  Fly   279 DNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEW 343
            ..||:|||||.....|.|||||.|.|.::.:|.|||.|||||:|:.|....||||||||....:|
  Fly   232 PASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDW 296

  Fly   344 ITLTTVNMPLPEEREEVPYASPTL 367
            |     ...:.:....||:|:..|
  Fly   297 I-----YEHMAQNSNSVPFAAGQL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 106/231 (46%)
Tryp_SPc 113..344 CDD:238113 106/231 (46%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 108/239 (45%)
Tryp_SPc 67..297 CDD:214473 106/231 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471538
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.