DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG15873

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:297 Identity:70/297 - (23%)
Similarity:117/297 - (39%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LIINEPITDPQCGFVNS-KGVTF------SFREEDTGLAQEAEVPWMVALLDARTSSYV------ 133
            ||::..::|...|.:.. ...||      .::.:...|::.        ::..||.:||      
  Fly    10 LILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRH--------VVSIRTKNYVRHRGDN 66

  Fly   134 --AGGALIAPHVVITARQ-RTENMTASQ----------LVVRAGEWDFSTKTEQLPSVDVPIRSI 185
              ..|.|::...|:||.. .|:...||.          .:.|...:|.|    ...|||    .:
  Fly    67 HFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDES----DFRSVD----RL 123

  Fly   186 VRHPGFNLENGANNVALVFLRRSLTSSRH-INPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMN 249
            |.||.:. ....|::|::.|...:.||.| :.|:.|...........||..|||: .:....|.|
  Fly   124 VVHPEYE-RYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQ-IYQHGPYSN 186

  Fly   250 VLKKISLPVVQR--RTCEQQLRLYYGNDFELDNSLMCAGGEPGKDS--CEGDGGSPLACAIKDNP 310
            .|  :.|.|:.|  ..|::    :| :.|..|:: :|.  ||..:|  |.||.|.||.|      
  Fly   187 EL--VYLDVILRPPSLCQK----HY-DTFTADHN-VCT--EPVGESMNCAGDMGGPLLC------ 235

  Fly   311 QRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLT 347
             :..|.|::...:.|. .|....:.:.....:||.||
  Fly   236 -KGALFGLIGGHMGCA-GGKAMKFLSFLYYKDWILLT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 59/254 (23%)
Tryp_SPc 113..344 CDD:238113 59/254 (23%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/248 (23%)
Tryp_SPc 59..250 CDD:238113 55/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.