DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG30414

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:306 Identity:78/306 - (25%)
Similarity:120/306 - (39%) Gaps:89/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITA----- 147
            :.|..||....:.:.......|.||...   ||||.:|..:    :.||:||....|:||     
  Fly    25 LLDSSCGTTKPEFIPMITGGADAGLFSN---PWMVKVLGEK----LCGGSLITSRFVLTAAHCIV 82

  Fly   148 -----------RQRTENMTASQLV--------VRAGEWD--FSTKTEQLP-SVDVPIRSIVRHPG 190
                       :.|......|:.|        :|.||:|  |..|...:| |.::.:...:.|..
  Fly    83 STHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHAD 147

  Fly   191 FNLENGANNVALVFLRRSLTSSRHINPIC------MPSAPKNFDFSRCIF--TGWGKNSFDDPSY 247
            :|| |..|::.|:.::..:..|.::.|||      |..:|        ||  ||||..:...||.
  Fly   148 YNL-NLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESP--------IFNITGWGVTNDGTPSR 203

  Fly   248 MNVLKKISLPVVQRRTCEQQLRLYYGNDF---------ELDNSLMCAGGEPGKDSCEGDGGSPLA 303
            .          :||.|       .|..|.         ::|.|.:||.| ...|:|.||.|.||:
  Fly   204 R----------LQRAT-------VYNTDLHFCRSKFTKQVDESQICAAG-TNSDACHGDSGGPLS 250

  Fly   304 CAIKDNPQ----RYELAGIVNFG-VDCGLPGVPAVYTNVANVIEWI 344
            ..:.....    :|   |:|::| ..|   ...:|||||.:..:||
  Fly   251 AQVPFAGSWLTFQY---GLVSYGSAAC---HSFSVYTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/279 (25%)
Tryp_SPc 113..344 CDD:238113 70/279 (25%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 73/288 (25%)
Tryp_SPc 41..290 CDD:238113 73/288 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.