DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG9294

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:297 Identity:87/297 - (29%)
Similarity:134/297 - (45%) Gaps:47/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IINEPI----TDPQCGFVNS--KGVTFSFREEDTGLAQEAEV---PWMVALLDARTSSYVAGGAL 138
            :.|.||    ...:||.:|:  |.|.          .||..|   |||..:|  ..:.:...|:|
  Fly    78 VANFPIERDCVTCRCGLINTLYKIVG----------GQETRVHQYPWMAVIL--IYNRFYCSGSL 130

  Fly   139 IAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVR----HPGFNLENGANN 199
            |....|:||....|.:....:.:|..|.:.|...:     |:.|:..|.    |..:|..:..|:
  Fly   131 INDLYVLTAAHCVEGVPPELITLRFLEHNRSHSND-----DIVIQRYVSRVKVHELYNPRSFDND 190

  Fly   200 VALVFLRRSLTSSRH-INPICMPSAPKNFDFSRCIFTGWG---KNSFDDPSYMNVLKKISLPVVQ 260
            :|::.|.:.|....| :.|||:|....:||....|..|||   :..|.    .:.|:::.:.|:.
  Fly   191 LAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIVAGWGAQREGGFG----TDTLREVDVVVLP 251

  Fly   261 RRTCEQQLRLYYGNDFELDNSLMCAG--GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGV 323
            :..|........|   ::.:::||||  .|.|||:|.||.|.||.....:.|.:|:|||||::||
  Fly   252 QSECRNGTTYRPG---QITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGV 313

  Fly   324 DCGLPGVPAVYTNVANVIEWITLTTVN----MPLPEE 356
            .|..|..|.|||.|...:.|:...|..    ||.|||
  Fly   314 GCARPQSPGVYTRVNQYLRWLGSNTPGGCHCMPYPEE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/243 (30%)
Tryp_SPc 113..344 CDD:238113 72/243 (30%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 74/256 (29%)
Tryp_SPc 101..334 CDD:238113 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.