DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and tpr

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:267 Identity:73/267 - (27%)
Similarity:128/267 - (47%) Gaps:25/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 INEP--ITDPQCGFVNSKGVTFSFREEDTGLAQEAEV---PWMVALLDARTSSYVAGGALIAPHV 143
            :|.|  .:|..||..|       .::...| .||.||   ||:..||..  ..:....:|:....
  Fly   107 LNPPRNCSDCVCGIAN-------IQKRIVG-GQETEVHQYPWVAMLLYG--GRFYCAASLLNDQF 161

  Fly   144 VITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRS 208
            ::||..........::.||..|.|  .|...:..:|..:..::.||.:|..|..|::|::.|...
  Fly   162 LLTASHCVYGFRKERISVRLLEHD--RKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEP 224

  Fly   209 LTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYG 273
            :..:..::|:|||:..::|.....|.||||......|: .:.|:::.:|::.:..|.:.   .||
  Fly   225 VEFNEVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPT-SDTLQEVQVPILSQDECRKS---RYG 285

  Fly   274 NDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNV 337
            |  ::.::::|.| .|.|||||:||.|.||. .:....:.:::||:|::|..|...|.|.||..|
  Fly   286 N--KITDNMLCGGYDEGGKDSCQGDSGGPLH-IVASGTREHQIAGVVSWGEGCAKAGYPGVYARV 347

  Fly   338 ANVIEWI 344
            .....||
  Fly   348 NRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/234 (27%)
Tryp_SPc 113..344 CDD:238113 64/234 (27%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 65/239 (27%)
Tryp_SPc 127..356 CDD:238113 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.