DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG11192

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:238 Identity:72/238 - (30%)
Similarity:119/238 - (50%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVAL-LDARTSSYVAGGALIAPHVVITARQRTEN-MTASQLVVRAGEWDFSTKTEQLPSVD 179
            |.|:.|:: |..|   ::.|||:|....|:||....|: .:::...||.|    |::.|....| 
  Fly    38 EFPYQVSVQLQGR---HICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVG----SSEHESGGHV- 94

  Fly   180 VPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSA--PKNFDFSRCIFTGWGKNSF 242
            :.:|.::.|..:|.::..|::||:.|...|..:.|:.|:.:.:.  |...| :|...:|||..:.
  Fly    95 LSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTAD-TRLQVSGWGFQAE 158

  Fly   243 DDPSYMNV-----LKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPL 302
            :......|     |:.:.:.:|:...|    |..|.....:...::|| ..||:|||:||.|.||
  Fly   159 ESAVSGEVGVSPQLRFVDVDLVESNQC----RRAYSQVLPITRRMICA-ARPGRDSCQGDSGGPL 218

  Fly   303 -ACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
             ..|.::.|.|  |.|||::|:.|..|..|.||||||....||
  Fly   219 VGYAAEEGPAR--LYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/236 (30%)
Tryp_SPc 113..344 CDD:238113 70/236 (30%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 70/236 (30%)
Tryp_SPc 28..262 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.