DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG10764

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:399 Identity:101/399 - (25%)
Similarity:165/399 - (41%) Gaps:83/399 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FSFREEDTGL-----------AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTA 156
            |.|.|...|:           |.|....||.|:.:  :|.:..||.:|....|::|....  :..
  Fly    23 FKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFN--SSDFQCGGTIIHMRFVLSAAHCL--VRG 83

  Fly   157 SQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP 221
            ..|.||.|..:.:.     |:....:.::..|..|......|::.|:.|..|:..:..:.|||:.
  Fly    84 YDLYVRLGARNINE-----PAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIF 143

  Fly   222 SAP---------KNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFE 277
            ..|         |.|   |.:  ||| |.....|.|  |:.|.|..::|..|:::|      :|.
  Fly   144 LDPALKGSVEKLKTF---RAL--GWG-NRNGKLSIM--LQTIYLLHLKRNECKRKL------NFN 194

  Fly   278 LDNSLMCAGGEPGKDSCEGDGGSPLACAIK-DNPQRYEL-AGIVNFGVDCGLPGVPAVYTNVANV 340
            |::..:|||.:.| |:|.||.|.||:..|. .:.:.||: .|||:|| |....|| .|||:|.:.
  Fly   195 LNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFG-DPECRGV-GVYTDVTSY 256

  Fly   341 IEWITLTTVN---MPLPEEREEVPYASPTLSAGPYLNQWNQPNYEWLPTGYPNVNSIPWQLQEAN 402
            ::||:.|...   :|:.....::...:|...         ..|..|.|...|.:.|:.:  ...:
  Fly   257 VDWISSTIARNDYLPIGVSGGDIAMGNPIAP---------DANRHWTPAASPPLPSMLY--NSCS 310

  Fly   403 NDLAN--SQYVRYYPVE-NVGINIHSAGHGNDQQIVRPIQQDIPKDSDDLF-----------NSV 453
            .|:|.  :|...|:|.. .||:.|      .||.|: ....|:|..:..|:           |.:
  Fly   311 QDIAAPIAQLRIYWPGSYAVGVLI------TDQLII-AAATDLPTVAAYLYVFVVLEGISAINQI 368

  Fly   454 FSTTMEYNF 462
            .|.:...||
  Fly   369 ESVSKHPNF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/241 (29%)
Tryp_SPc 113..344 CDD:238113 69/241 (29%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 69/248 (28%)
Tryp_SPc 38..263 CDD:238113 71/250 (28%)
Tryp_SPc 317..512 CDD:214473 16/68 (24%)
Tryp_SPc 317..512 CDD:304450 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.