DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG4927

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:311 Identity:85/311 - (27%)
Similarity:140/311 - (45%) Gaps:51/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ICC--PKNLIIKEPRLIINEPIT--DPQCGFVNSKGVTFSFREEDTGLAQEA--EVPWMVALLDA 127
            :||  |.|:..:..:...|..:.  :.:|...|....:........|.|:.|  |.|:| |||..
  Fly    61 VCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPFM-ALLGQ 124

  Fly   128 R--TSSYV---AGGALIAPHVVITA----------RQRTE-NMTASQLVVRAGEWDFSTKTEQLP 176
            |  .||.:   .|..:|.|..|:||          .||.: |....:.|||.||.|:::.|:...
  Fly   125 RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQ 189

  Fly   177 SVDVPIRSIVRHPGFNLENGA----NNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGW 237
            ..|..:.:.|.||.:..::..    |::|:|.|....|.|.::.|.|:|....| :..:....||
  Fly   190 PQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGN-EQLQVAAAGW 253

  Fly   238 GKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELD-NSLMCAGG-EPGKDSCEGDGGS 300
            |..|....:..::| |:||.......|.|:|      :.::| .:.:|||. ....|:|.||.|.
  Fly   254 GATSESGHASSHLL-KVSLDRYDVAECSQRL------EHKIDVRTQLCAGSRSTSADTCYGDSGG 311

  Fly   301 PL-------ACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |:       :| :|      ::.||.::|:.||:.|:|:|||.|....:||
  Fly   312 PVFVQHPIYSC-LK------QVIGITSYGLVCGVQGLPSVYTKVHLYTDWI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 75/261 (29%)
Tryp_SPc 113..344 CDD:238113 75/261 (29%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 78/267 (29%)
Tryp_SPc 105..355 CDD:214473 76/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.