DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Tmprss4

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:414 Identity:99/414 - (23%)
Similarity:168/414 - (40%) Gaps:100/414 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IIAIVSLILVAGQVQA-----------------QGQNAELNQSC--GASNEHQCVPRHMCKVKIE 52
            |:::::|.:||..::.                 :||..:.:..|  |...|| ||.....|..:.
  Rat    81 ILSLIALGIVALLIKVVLDKYYFICGNPLTFIPRGQMCDGHLDCASGEDEEH-CVKNFPEKPGVT 144

  Fly    53 FRMAMTYRNLGCVSTA------IC------------CPKNLIIKEP----------RLIINEPIT 89
            .|::.....|..:..|      :|            |.:.....:|          :.::..|:|
  Rat   145 VRLSKDRSTLQVLDAARGTWASVCFDNFTEALAKTACRQMGYNSQPAFGPVEMGPNQTLLVTPVT 209

  Fly    90 DPQCGFVNSK-------------GVTFSFREEDTGLA---------QEAEV---PWMVALLDART 129
            .      ||:             |...|.|..|.|.:         .||..   ||.|::  ...
  Rat   210 G------NSQELQMQNGSRSCLSGSLVSLRCLDCGKSLKTTRVVGGVEASADSWPWQVSI--QYN 266

  Fly   130 SSYVAGGALIAPHVVITARQ-RTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSI-VRHPGFN 192
            ..:|.||:::..|.::||.. ..:.:..|...||||    |.|....||  :|:..| :..|. .
  Rat   267 KQHVCGGSILDHHWILTAAHCFRKYLDVSSWKVRAG----SNKLGNSPS--LPVAKIFIAEPN-P 324

  Fly   193 LENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFT-GWGKNSFDDPSYMNVLKKISL 256
            |:....::|||.|:..||.|..:.|||:|.:.:....:..::. |||....:.....:.|.:.|:
  Rat   325 LQPKEKDIALVKLKMPLTFSGSVRPICLPFSDEELIPTMPVWVIGWGFTEENGGKMSDTLLQASV 389

  Fly   257 PVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVN 320
            .|:....|..: ..|.|   |:...::||| .:.|||:|:||.|.||..    :..::::.|||:
  Rat   390 QVIDSARCNAE-DAYQG---EVTAGMLCAGTPQGGKDTCQGDSGGPLMY----HYDKWQVVGIVS 446

  Fly   321 FGVDCGLPGVPAVYTNVANVIEWI 344
            :|..||.|..|.|||.|...::||
  Rat   447 WGYGCGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/246 (28%)
Tryp_SPc 113..344 CDD:238113 69/246 (28%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060 6/34 (18%)
SRCR_2 149..238 CDD:413346 13/94 (14%)
Tryp_SPc 245..470 CDD:214473 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.