DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss39

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006244779.1 Gene:Prss39 / 363215 RGDID:1309276 Length:371 Species:Rattus norvegicus


Alignment Length:333 Identity:73/333 - (21%)
Similarity:134/333 - (40%) Gaps:52/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NEPITDPQC---GFVNSKGVTFSFREEDTG--LAQEAEVPWMVALLDARTSSYVAGGALIAPHVV 144
            |.|..:.:|   |.|::......|:.:..|  :|:....||..:|:  ....::.|..||..:.|
  Rat    45 NGPCPEGKCLVAGIVSTVCGKTKFQGKIYGGSIAKAERWPWQASLI--FRGRHICGAVLIDKNWV 107

  Fly   145 ITARQ-RTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFN-LENGANNVALVFLRR 207
            .:|.. ...::..|...:..|..:.|..:..  |..:.:..::.|..:| |.:...::.|:.|..
  Rat   108 ASAAHCFKRSLKPSDYRILLGYNELSNPSNY--SRQMTLSKVIVHEDYNKLHSQEKDIVLIQLHL 170

  Fly   208 SLTSSRHINPICMP-SAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLP---------VVQRR 262
            .:..|.||.|:|:| ...|......|..:|||..:.|        |.:..|         ::..:
  Rat   171 PVRYSSHIFPVCVPDQTTKEPSDESCWISGWGMVTDD--------KFLQAPFPLLDSEVFLMNDQ 227

  Fly   263 TCEQQLRLYYGNDFELD---NSLMCAGGEPG-KDSCEGDGGSPLACAIKDNPQRYELAGIVNFGV 323
            .||...:....:..|.|   :.::|||.... |.:|.||.|.||.|.:   ...:.|.|:.::..
  Rat   228 ECEAFFQTPQISITEYDAIKDDMICAGDITNQKSTCRGDSGGPLVCLL---DSYWYLVGLASWSG 289

  Fly   324 DCGLP-GVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLS----AGPYLNQWNQPNYEW 383
            .|..| ..|:::|.|::..:||         .:::.:.|...|:|:    ..|.|..|.  ||..
  Rat   290 ACLEPIHSPSIFTRVSHFSDWI---------EKKKADTPDVDPSLAPLEETAPSLIGWR--NYSA 343

  Fly   384 LPTGYPNV 391
            ..|..|.:
  Rat   344 GTTLEPRI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 54/247 (22%)
Tryp_SPc 113..344 CDD:238113 54/247 (22%)
Prss39XP_006244779.1 Tryp_SPc 71..311 CDD:214473 55/254 (22%)
Tryp_SPc 72..314 CDD:238113 57/265 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.