DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:269 Identity:79/269 - (29%)
Similarity:130/269 - (48%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQL-- 175
            |...||||.|:|.:.  |.:..|..::....:::|.....:....|:....|       |..|  
Human   544 AASGEVPWQVSLKEG--SRHFCGATVVGDRWLLSAAHCFNHTKVEQVRAHLG-------TASLLG 599

  Fly   176 ---PSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR-CIFTG 236
               ..|.:.:|.:|.||.:|......::|::.|...|..:::|.|:|:|.|.:.|...| |:.:|
Human   600 LGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELASPLAFNKYIQPVCLPLAIQKFPVGRKCMISG 664

  Fly   237 WGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGS 300
            ||.....:.:...:|:|.|:.::.::||..   ||   :|.|.:.::|||...|| |||:||.|.
Human   665 WGNTQEGNATKPELLQKASVGIIDQKTCSV---LY---NFSLTDRMICAGFLEGKVDSCQGDSGG 723

  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPL----PEEREEVP 361
            ||||  ::.|..:.|||||::|:.|.....|.|||.:..:..||.....:.||    |.....:.
Human   724 PLAC--EEAPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILEIMSSQPLPMSPPSTTRMLA 786

  Fly   362 YASPTLSAG 370
            ..||..:||
Human   787 TTSPRTTAG 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/237 (30%)
Tryp_SPc 113..344 CDD:238113 70/237 (30%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.