DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG1773

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:317 Identity:78/317 - (24%)
Similarity:121/317 - (38%) Gaps:67/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CVSTAICCPKNLIIKEP----RLIINEPITDPQCGFVNSKGVTFSFREEDTG------LAQEAEV 118
            |:|   |.|.:...:|.    .|:..|.:|...||.:::.......|...||      |:|    
  Fly    16 CLS---CPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQ---- 73

  Fly   119 PWMVAL-LDARTSSYVAGGALIAPHVVITARQRTENMTAS-QLVVRAGEWDFSTKTE-------- 173
            |||..| :.........||:|::...|:||....:....| ::.|..||.|.|:.::        
  Fly    74 PWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQR 138

  Fly   174 --QLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFS-----R 231
              .||..:..|...:.|..|||.....::||:.|.:.:....||.|||:|...:...|:     .
  Fly   139 VCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQS 203

  Fly   232 CIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGND---FELDNSLMCAGGEPGKDS 293
            .:..|||:..                  .||.....:.::...:   ...|.|.:||.|: ..|:
  Fly   204 YMAVGWGRTE------------------SRRFANSTMEVHINTEKCTDGRDTSFLCANGD-YVDT 249

  Fly   294 CEGDGGSPLACAIKDNPQRYELAGIVNFGV------DCGLPGVPAVYTNVANVIEWI 344
            |.||.|.||..    ....:..|..|.|||      :|| .|..|.|.:|...:.||
  Fly   250 CTGDSGGPLIW----KTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/256 (24%)
Tryp_SPc 113..344 CDD:238113 62/256 (24%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 65/267 (24%)
Tryp_SPc 62..301 CDD:238113 65/266 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.