DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and f9a

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_878288.2 Gene:f9a / 359826 ZFINID:ZDB-GENE-030714-2 Length:503 Species:Danio rerio


Alignment Length:402 Identity:106/402 - (26%)
Similarity:153/402 - (38%) Gaps:106/402 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GQNAEL--NQSCGASN---EHQCV--PRH-----------------MCKVKIEFRMAMT------ 58
            |:|.|:  .:.|...|   ||.||  ..|                 .|:..::|....|      
Zfish   116 GKNCEIVTAKKCDVDNGGCEHFCVLLESHKTQCQCAYGYKLSEDGLTCEPIVKFPCGKTSKPAVK 180

  Fly    59 -------------YRNLGCVST-AICCPKNLI-------IKE---------PRLIINEPITDPQC 93
                         :.|:...|| :|..|.||.       |||         |:....|.:|.|..
Zfish   181 TYGTASVTNTTAQFSNMTVKSTSSIPKPDNLTNPTNSKDIKEKLAPPRAKLPKWAFEEYLTSPAP 245

  Fly    94 GFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQ 158
            .....|.     |......|...|:||.|||:...|.....||:::.|..||||...........
Zfish   246 TVSGPKS-----RIIGGNSALPGEIPWQVALVSRSTQQVFCGGSILNPLWVITAAHCLLGNHNGS 305

  Fly   159 LVVRAGEWDFS--TKTEQLPSVDVPIRSIVRHPGFNLENGANN--VALVFLRRSLTSSRHINPIC 219
            ..:|.||.|.|  ..|||    :|.:..::.||.:|.:....|  :||:.||..:..:..:.|||
Zfish   306 FYIRVGEHDVSKIEGTEQ----NVDVIKLISHPRYNSKVSLFNHDIALLRLRSPIRLTPTVRPIC 366

  Fly   220 M-PSAPKNFDFSRCIF--------TGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGND 275
            : |..     ||..:.        :|||:..|...| ...|:||.||.|.|..|::      .:.
Zfish   367 LGPMV-----FSNTLLQSGTLATVSGWGRVRFQGRS-AATLQKIELPYVDRTVCKE------SSS 419

  Fly   276 FELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYE----LAGIVNFGVDCGLPGVPAVYT 335
            ..:.:.:.||| .:..||:|:||.|.|       :..||.    |.||:::|.:|...|...|||
Zfish   420 DPITHFMFCAGHSDSPKDACQGDSGGP-------HVMRYHNTWFLTGIISWGEECAKKGKYGVYT 477

  Fly   336 NVANVIEWITLT 347
            .|.|...||..|
Zfish   478 QVGNYYRWIQHT 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 74/248 (30%)
Tryp_SPc 113..344 CDD:238113 74/248 (30%)
f9aNP_878288.2 GLA 19..83 CDD:214503
EGF_CA 84..120 CDD:238011 2/3 (67%)
FXa_inhibition 127..163 CDD:291342 7/35 (20%)
Tryp_SPc 253..486 CDD:214473 75/255 (29%)
Tryp_SPc 254..489 CDD:238113 76/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.