DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Np

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:229 Identity:68/229 - (29%)
Similarity:122/229 - (53%) Gaps:6/229 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYV--AGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP 181
            ||.::|...|||:|:  .|.||:..:..|||....:|:..|.|::|.||:|.:.:.|.....:..
  Fly   810 PWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDLAEEEEPYGYQERR 874

  Fly   182 IRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPS 246
            ::.:..||.|:......::||:.....:....:|.|:|:|...:||.......||||: .::|..
  Fly   875 VQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENFIGQTAFVTGWGR-LYEDGP 938

  Fly   247 YMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEP-GKDSCEGDGGSPLACAIKDNP 310
            ..:||:::::||:....||...| ..|....:.:..:|||.:. |.||||||.|.|:... :::.
  Fly   939 LPSVLQEVAVPVINNTICESMYR-SAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQ-RESD 1001

  Fly   311 QRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            :|:.|.|::::|:.|.....|.|||.::...:||
  Fly  1002 KRFHLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/227 (29%)
Tryp_SPc 113..344 CDD:238113 66/227 (29%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 66/227 (29%)
Tryp_SPc 798..1038 CDD:238113 68/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.