DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Jon44E

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:130/268 - (48%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PITD-PQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQR 150
            |:.| |:.|.:..: :|..:.      |.|.::|::|. |......|..||::|....|:||...
  Fly    27 PVKDMPRAGKIEGR-ITNGYP------AYEGKIPYIVG-LSFNDGGYWCGGSIIDHTWVLTAAHC 83

  Fly   151 TENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRR----SLTS 211
            |.  :|:.:::..|.   |.:.|...:..|....:::||.:| :...|::||:.:..    ||  
  Fly    84 TN--SANHVLIYFGA---SFRHEAQYTHWVSRSDMIQHPDWN-DFLNNDIALIRIPHVDFWSL-- 140

  Fly   212 SRHINPICMPSAPKNFD-FSR--CIFTGWGKNSFDDPSYM-NVLKKISLPVVQRRTCEQQLRLYY 272
               :|.:.:||....:: :|.  .:.:|||..  |:.|.| |.|..:.:.::....|    |.||
  Fly   141 ---VNKVELPSYNDRYNSYSGWWAVASGWGLT--DNNSGMSNYLNCVDVQIIDNNDC----RNYY 196

  Fly   273 GNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCG-LPGVPAVYTN 336
            |:::..||:: |...:.||.||.||.|.||  .:.||.:   :.|||:||...| ..|.||.:|.
  Fly   197 GSNYITDNTI-CINTDGGKSSCSGDSGGPL--VLHDNNR---IVGIVSFGSGEGCTAGRPAGFTR 255

  Fly   337 VANVIEWI 344
            |...::||
  Fly   256 VTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/239 (28%)
Tryp_SPc 113..344 CDD:238113 68/239 (28%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 69/253 (27%)
Tryp_SPc 41..266 CDD:238113 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.