DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Corin

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:255 Identity:69/255 - (27%)
Similarity:122/255 - (47%) Gaps:28/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQL--------VVRAGEWDFSTKTEQL 175
            |::.|:|......:...|.||:...|:||.....|.:...|        |.|...:.:|.:    
  Fly  1116 PFLAAILGGPEKIFYCAGVLISDQWVLTASHCVGNYSVIDLEDWTIQLGVTRRNSFTYSGQ---- 1176

  Fly   176 PSVDVPIRSIVRHPGFNLENG-ANNVALVFLRRSLTSSRHINPICM--PSAPKNFDFSRCIFTGW 237
               .|.:::::.||.:|:... .|::||..|...:....|:.|:|:  ||.......:.|...||
  Fly  1177 ---KVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCLPPPSVRNLHPGTLCTVIGW 1238

  Fly   238 GKNSFDDP--SYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGG 299
            ||....||  :|..::.::.:|::.|..|::.|     ::..:...::||| .:.|||:|:||.|
  Fly  1239 GKREDKDPKSTYEYIVNEVQVPIITRNQCDEWL-----DNLTVSEGMVCAGFDDGGKDACQGDSG 1298

  Fly   300 SPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI--TLTTVNMPLPEER 357
            .||.|.......|:.:.|||::|:.|..|.:|.||.||...:.||  .:...:.|:.|:|
  Fly  1299 GPLLCPYPGEKNRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWIQEQIAKHSRPIKEDR 1358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/238 (27%)
Tryp_SPc 113..344 CDD:238113 64/238 (27%)
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473 64/238 (27%)
Tryp_SPc 1104..1346 CDD:238113 66/241 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.