DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG17571

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:250 Identity:75/250 - (30%)
Similarity:125/250 - (50%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GVTFSFREEDTGLAQEAE-VPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRA 163
            |:.|.|.....|...:.| .|:.|::...: .|:..||:||....|:||....::..||:|.||.
  Fly    23 GLDFPFGRIVNGEDVDIENYPYQVSVQTTK-GSHFCGGSLIDSETVLTAAHCMQSYAASELQVRV 86

  Fly   164 GEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFD 228
            |....|:..|.     |.:|:...|.|:|.:...|:||::.|...:..:..|..|.:..: :...
  Fly    87 GSTSRSSGGEV-----VTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADS-EAVS 145

  Fly   229 FSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDS 293
            .:..:.:|||...|...|..:.|:|:.:.::..:.|... ...||:|..|: :::||.||. ||:
  Fly   146 GTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAAD-TYNYGSDSILE-TMVCATGEK-KDA 207

  Fly   294 CEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTT 348
            |:||.|.||   :.||    :|.|:|::|..|...|.|.||.:||::..||..||
  Fly   208 CQGDSGGPL---VADN----KLVGVVSWGSGCAWTGYPGVYADVASLRSWIVDTT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/231 (29%)
Tryp_SPc 113..344 CDD:238113 67/231 (29%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 68/237 (29%)
Tryp_SPc 31..254 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.