DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss21

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:262 Identity:74/262 - (28%)
Similarity:124/262 - (47%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QEAEV---PWMVALLDART-SSYVAGGALIAPHVVITARQ--RTEN------MTASQLVVRAGEW 166
            :|||:   ||..:|   |. .:::.|..|:....|:||..  :.:|      :...:|..|...|
  Rat    62 EEAELGRWPWQGSL---RVWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPSLW 123

  Fly   167 DFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFS 230
            :.     |..|....|..|...|.:. |...:::||:.|...:|.|..|.|||:.::...| :.:
  Rat   124 NL-----QAYSNRYQIEDIFLSPKYT-EQFPHDIALLKLSSPVTYSNFIQPICLLNSTYKFANRT 182

  Fly   231 RCIFTGWGKNSFDDPSYM-NVLKKISLPVVQRRTCEQQLRLYYGNDFELD--NSLMCAGG-EPGK 291
            .|..||||....|:...: |.|:::.:.::....|.   .|:...||.::  ..::|||. |.||
  Rat   183 DCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMCN---HLFKKPDFRINIWGDMVCAGSPEGGK 244

  Fly   292 DSC---------EGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLT 347
            |:|         :||.|.||.|  ..:...|:: |:|::|:.||.|..|.||||:::...||.||
  Rat   245 DACFAKLTYAAPQGDSGGPLVC--NQDTVWYQV-GVVSWGIGCGRPNRPGVYTNISHHYNWIRLT 306

  Fly   348 TV 349
            .:
  Rat   307 MI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/255 (27%)
Tryp_SPc 113..344 CDD:238113 70/255 (27%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 70/255 (27%)
Tryp_SPc 58..304 CDD:238113 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.