DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss33

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:244 Identity:79/244 - (32%)
Similarity:119/244 - (48%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQ-RTENMTASQLVVRAGEWDFSTKTEQLP 176
            ||:.|.||..::  ....::|.||:||||..|:||.. ....:..|:..|..|......::..  
Mouse   104 AQDGEWPWQTSI--QHRGAHVCGGSLIAPQWVLTAGHCFPRRVWPSEYSVLLGALSLDVRSSH-- 164

  Fly   177 SVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF--DFSRCIFTGWGK 239
            .:.||:..::..|.::.:....::||:.||..::.|..|.|:|:| ||.:.  ..|.|..||||.
Mouse   165 ELLVPVLRVLLPPDYSEDEARGDLALLQLRHPVSLSTRIQPVCLP-APGSHPPPGSPCWVTGWGS 228

  Fly   240 NSFDDP-SYMNVLKKISLPVVQRRTCEQQLRLYY-------GNDFELDNSLMCAGGEPG-KDSCE 295
            .|...| .....|:.:.:|::..|.|:   |||:       |....|..:| |||...| ||:|:
Mouse   229 LSPGVPLPKGRPLQGVRVPLLDSRACD---RLYHVGANVPQGERIVLPGNL-CAGYRRGHKDACQ 289

  Fly   296 GDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ||.|.||.|.   ....:.|.|:|::|..|.||..|.||||||....||
Mouse   290 GDSGGPLTCM---ESGHWVLVGVVSWGKGCALPNRPGVYTNVAKYSPWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 77/242 (32%)
Tryp_SPc 113..344 CDD:238113 77/242 (32%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.