DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG17572

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:368 Identity:103/368 - (27%)
Similarity:152/368 - (41%) Gaps:93/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VQAQGQNAELNQSCGASNEHQCVPRHMCKVKI-EFRMAMTY--RNLGCVSTA-----ICCPKNLI 76
            ||..||.       |.|...:|.|.|.|...| |...:..|  ::|.|..::     :|||    
  Fly    61 VQNAGQT-------GCSVGTECTPLHDCTALIYEVARSCYYGDKSLYCGGSSEELPYVCCP---- 114

  Fly    77 IKEPRLIINEPITDPQ-CG-------FVNSKG-----VTFSFREEDTGLAQEAEVPWMVALLDAR 128
                    :.|:...| ||       |....|     ....|:..:||                 
  Fly   115 --------SSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTG----------------- 154

  Fly   129 TSSYVAGGALIAPHVVITARQ----RTENMTASQLVVRAGEWDFSTKTE-------QLPSVDVPI 182
            ..:|...||:||..|::||..    :.:....|.  ||.||:|.|:..:       ...||:..|
  Fly   155 AFAYPCAGAVIARRVILTAAHCALAKADGHRLSS--VRVGEYDTSSDPDCANTGFCAPRSVNHAI 217

  Fly   183 RSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF-SRCIFTGWGK---NSFD 243
            ..::.||.:......:::||:.|:..|..|....|||:.....|... .|....||||   :|..
  Fly   218 SHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVR 282

  Fly   244 DPSYMNVLKKISLPVVQRRTCEQQLRLYYGND--FELDNSL----MCAGGEPGKDSCEGDGGSPL 302
            .|.    :..:.:|:.....|.:.    ||:.  .|..||:    |||||| |||.|:|.||:||
  Fly   283 QPE----MSHLDVPLTSWDLCLRN----YGSTGALESPNSIEGQWMCAGGE-GKDVCQGFGGAPL 338

  Fly   303 ACAIKDNPQRYELAGIVNFGVD-CGLPGVPAVYTNVANVIEWI 344
              .|::| ..:...||::||.| ||...:|:|||:||:..|||
  Fly   339 --FIQEN-GIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 74/252 (29%)
Tryp_SPc 113..344 CDD:238113 74/252 (29%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 80/272 (29%)
Tryp_SPc 138..378 CDD:214473 78/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.