DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and SPH93

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:266 Identity:113/266 - (42%)
Similarity:154/266 - (57%) Gaps:18/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ITDPQCGFVNS------KGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVIT 146
            :..|.||..|:      :|:|..       .|:.|:.||.||:.  ....|:|||:||.|:||:|
  Fly   228 LLSPSCGMSNANGLQMVEGITID-------QARPAQYPWAVAIF--HNGQYLAGGSLIQPNVVLT 283

  Fly   147 ARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTS 211
            ...|...: .::||||||:||..:..|...|....:...|.|.||:.::||||:||:||......
  Fly   284 VAHRVITI-ETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKL 347

  Fly   212 SRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLR-LYYGND 275
            :.||..||:|:..|:|...||...||||..::|..|..||||:.|.||.|..||:.|| ...|..
  Fly   348 NDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAK 412

  Fly   276 FELDNSLMCAGGEPGKDSCEGDGGSPLACAI-KDNPQRYELAGIVNFGVDCGLPGVPAVYTNVAN 339
            |||..:::|||||.|:|:|.|||||.|.|:| .:|...||.|||||:||.||..|:||:||.|:.
  Fly   413 FELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSK 477

  Fly   340 VIEWIT 345
            ...|||
  Fly   478 FTNWIT 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 104/232 (45%)
Tryp_SPc 113..344 CDD:238113 104/232 (45%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 107/244 (44%)
Tryp_SPc 252..482 CDD:214473 104/232 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471546
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.