DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG18478

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:260 Identity:108/260 - (41%)
Similarity:151/260 - (58%) Gaps:4/260 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQR 150
            :.|.:.:||:.|...|...|...: |.|:.||.||.:|::..|  |.|.||:||.|.:|:||..|
  Fly    24 QQIEELKCGYGNPDAVKVQFNVTE-GQAKPAEFPWTIAVIHNR--SLVGGGSLITPDIVLTAAHR 85

  Fly   151 TENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHI 215
            ..|.....:||.||||::.:..|:.|..:..:..:|.|..||.:.||||:||:||.|....:..|
  Fly    86 IFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKI 150

  Fly   216 NPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLR-LYYGNDFELD 279
            |.||:|:..::...:|||..||||..|.|..|..|||||.||:|.|..|:.||| ...|.::.|.
  Fly   151 NTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLP 215

  Fly   280 NSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ..|:|||||...|:|.||||..|.|.:.::|:::|..||||:||.|....|||.||:|.....||
  Fly   216 RGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280

  Fly   345  344
              Fly   281  280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 99/231 (43%)
Tryp_SPc 113..344 CDD:238113 99/231 (43%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 101/233 (43%)
Tryp_SPc 50..280 CDD:214473 99/231 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471534
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.