DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG4650

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:339 Identity:84/339 - (24%)
Similarity:125/339 - (36%) Gaps:79/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DPQCGFV-NSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTEN 153
            |.:||.: |.|            :|.....||| |.|......||.||.:|...:|:||...|. 
  Fly    25 DGRCGLLTNGK------------IANNISSPWM-AYLHTSELLYVCGGTVITEKLVLTAAHCTR- 75

  Fly   154 MTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPI 218
             .:.|||.|.||:..:.........:..:.....|..:|....||::|::.|...:..|:.|.||
  Fly    76 -ASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPI 139

  Fly   219 CMP--SAPKNFDFSRCIFTG--WGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELD 279
            |:.  :..:.:..:..:.:|  ||.     |:..|......:..::|:.......|   |...:.
  Fly   140 CIVWWTIWRKYIDNIQVLSGAQWGL-----PNDRNESDAFRITDIRRQPANMCSTL---NGTAIL 196

  Fly   280 NSLMCAGGEPGKDSCEGDGGSPLACAIK-DNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEW 343
            :|..|||....| .|..|..|||...|. .|.|||.|.||......|..   .:|||:|.:..::
  Fly   197 SSQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQRYVLIGIATTNQKCKR---ASVYTDVLSHTDF 257

  Fly   344 ITLTTVNMPLPEEREEVPYASPTLSAGPYLNQWNQPNYEWLPTGYPNVNSIP--WQLQEANNDL- 405
            |                            |:.|.|         |.|....|  |.||. |.|: 
  Fly   258 I----------------------------LSVWRQ---------YRNGEKSPKTWDLQN-NFDVE 284

  Fly   406 -----ANSQYVRYY 414
                 |||:...|:
  Fly   285 NTTLKANSEEEHYF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 63/235 (27%)
Tryp_SPc 113..344 CDD:238113 63/235 (27%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/251 (26%)
Tryp_SPc 33..258 CDD:304450 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.