DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:263 Identity:81/263 - (30%)
Similarity:127/263 - (48%) Gaps:24/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QCGFVNSKGVTFSFREEDTGL-AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMT 155
            |||  |...||........|: |...|.||:..|.  ::.....||:||....::||......||
  Fly   386 QCG--NKNPVTPDQERIVGGINASPHEFPWIAVLF--KSGKQFCGGSLITNSHILTAAHCVARMT 446

  Fly   156 A---SQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINP 217
            :   :.|....|:::..|..| :..|...|:.:|||.||......|:||::.|...:..:|.|.|
  Fly   447 SWDVAALTAHLGDYNIGTDFE-VQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQP 510

  Fly   218 ICMPSAP----KNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFE- 277
            ||:|::|    :::........|||....:.|. .::|:|:.:|:.....|.::    ||.... 
  Fly   511 ICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQ-PSILQKVDIPIWTNAECARK----YGRAAPG 570

  Fly   278 -LDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVI 341
             :..|::|| |:..||||.||.|.|:  .|.|. .||...|||::|:.||....|.|||.|.:::
  Fly   571 GIIESMICA-GQAAKDSCSGDSGGPM--VINDG-GRYTQVGIVSWGIGCGKGQYPGVYTRVTSLL 631

  Fly   342 EWI 344
            .||
  Fly   632 PWI 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/239 (30%)
Tryp_SPc 113..344 CDD:238113 72/239 (30%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 73/246 (30%)
Tryp_SPc 400..637 CDD:238113 75/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.