DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:170 Identity:56/170 - (32%)
Similarity:88/170 - (51%) Gaps:16/170 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PIRSIVRHPGFNLENGANNVALVFLRRSL----TSSRHINPICMPSAPKNF-DFSRCIFTGWGKN 240
            |:|.||.|..:|.:....::||  |:.|:    |..:.|.|||:|...:.. ...:|..||||:.
Human   676 PVRRIVVHEYYNSQTFDYDIAL--LQLSIAWPETLKQLIQPICIPPTGQRVRSGEKCWVTGWGRR 738

  Fly   241 SFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGSPLAC 304
            ...|.....||::..:.::.:..|...    ||   .:.:.::|||...|| |:|:||.|.||:|
Human   739 HEADNKGSLVLQQAEVELIDQTLCVST----YG---IITSRMLCAGIMSGKRDACKGDSGGPLSC 796

  Fly   305 AIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ..|.: .::.|.|||::|...|.|..|.|||.|:|.:.||
Human   797 RRKSD-GKWILTGIVSWGHGSGRPNFPGVYTRVSNFVPWI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 54/168 (32%)
Tryp_SPc 113..344 CDD:238113 54/168 (32%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.