DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Try29F

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:75/252 - (29%)
Similarity:115/252 - (45%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTE--- 173
            :|...::|:.|:|   :.|.:..||:|||...|:||...||........||.|    |::|.   
  Fly    47 VANIKDIPYQVSL---QRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIG----SSRTSVGG 104

  Fly   174 QLPSVDVPIRSIVRHPGFNL-------------ENGANNVALVFLRRSLTSSRHINPICMPSAPK 225
            ||    |.|:.:.|||.|:.             |..|.||...|             :.:|....
  Fly   105 QL----VGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAF-------------VGLPEQDA 152

  Fly   226 NF-DFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GE 288
            :. |.:..:.:||| |:........||:.:::|.|.:..|.:.    |||...:.:.::||| .|
  Fly   153 DIADGTPVLVSGWG-NTQSAQETSAVLRSVTVPKVSQTQCTEA----YGNFGSITDRMLCAGLPE 212

  Fly   289 PGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWIT 345
            .|||:|:||.|.|||.   |.    .|.|:|::|..|..|..|.||:.|:.|.:||:
  Fly   213 GGKDACQGDSGGPLAA---DG----VLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 73/248 (29%)
Tryp_SPc 113..344 CDD:238113 73/248 (29%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 73/249 (29%)
Tryp_SPc 42..264 CDD:238113 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.