DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and OVCH2

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:251 Identity:68/251 - (27%)
Similarity:122/251 - (48%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMT-ASQLVVRAGEWDFSTKT--EQL 175
            ::...||.|:|  .:...::.||::::|..||||.....|.. .|.|.|.|||:|.|...  || 
Human    63 EKGSYPWQVSL--KQRQKHICGGSIVSPQWVITAAHCIANRNIVSTLNVTAGEYDLSQTDPGEQ- 124

  Fly   176 PSVDVPIRSIVRHPGFNLENGAN-NVALVFLRRSLTSSRHINPICMPSAPKNFDFS-RCIFTGWG 238
               .:.|.:::.||.|:.:...: ::||:.:..:......:.|||:|...:.|:.. .|...|||
Human   125 ---TLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVGPICLPELREQFEAGFICTTAGWG 186

  Fly   239 KNSFDDPSYMNVLKKISLPVVQRRTCEQQL----RLYYGNDFELDNSLMCAG-GEPGKDSCEGDG 298
            :.: :......||::::||::....|...|    |...|..|      :|.| .:.|:|:|:||.
Human   187 RLT-EGGVLSQVLQEVNLPILTWEECVAALLTLKRPISGKTF------LCTGFPDGGRDACQGDS 244

  Fly   299 GSPLACAIKDNPQRYELAGIVNFGVDCGL----------PGVPAVYTNVANVIEWI 344
            |..|.|  ::....:.|||:.::|:.||.          .|.|.::|:::.|:.||
Human   245 GGSLMC--RNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGSPGIFTDISKVLPWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/249 (27%)
Tryp_SPc 113..344 CDD:238113 66/249 (27%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 66/249 (27%)
Tryp_SPc 56..301 CDD:238113 68/251 (27%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.