DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and TMPRSS11A

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_872412.3 Gene:TMPRSS11A / 339967 HGNCID:27954 Length:421 Species:Homo sapiens


Alignment Length:305 Identity:76/305 - (24%)
Similarity:127/305 - (41%) Gaps:52/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IKEPRL--IINEPITDPQCGFVNSKGVTFSFREEDTG------------------------LAQE 115
            ::|.::  |:|:.|.:.:...:|:..|..:.....||                        :|.:
Human   134 VREKKIQSILNQKIRNLRALPINASSVQVNAMSSSTGELTVQASCGKRVVPLNVNRIASGVIAPK 198

  Fly   116 AEVPWMVALLDARTSSYVAGGALIAPHVVITAR---QRTENMTASQLVVRAGEW--DFSTKTEQL 175
            |..||..:|  ...:.:..|..||:...::||.   |:.:|         ..:|  .|.||... 
Human   199 AAWPWQASL--QYDNIHQCGATLISNTWLVTAAHCFQKYKN---------PHQWTVSFGTKINP- 251

  Fly   176 PSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCI-FTGWGK 239
            |.:...:|..:.|..:.......::|:|.:...:|.|..|..||:|.|..:|..:..: .||:|.
Human   252 PLMKRNVRRFIIHEKYRSAAREYDIAVVQVSSRVTFSDDIRQICLPEASASFQPNLTVHITGFGA 316

  Fly   240 NSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPG-KDSCEGDGGSPLA 303
            ..:...| .|.|::..:.::....|:|.  ..||||  :...:.|||...| .|:|.||.|.|| 
Human   317 LYYGGES-QNDLREARVKIISDDVCKQP--QVYGND--IKPGMFCAGYMEGIYDACRGDSGGPL- 375

  Fly   304 CAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTT 348
             ..:|....:.|.|||::|.:||....|.|||.|.....||...|
Human   376 -VTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIASKT 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 65/237 (27%)
Tryp_SPc 113..344 CDD:238113 65/237 (27%)
TMPRSS11ANP_872412.3 SEA 49..147 CDD:279699 3/12 (25%)
Tryp_SPc 189..415 CDD:214473 65/244 (27%)
Tryp_SPc 190..418 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.