DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and PRSS38

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:325 Identity:84/325 - (25%)
Similarity:140/325 - (43%) Gaps:58/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LIIKEPR---LIINEP------IT-DPQCGFVNSKGVTFSFREEDTGL-AQEAEVPWMVALLDAR 128
            |::..||   |:..:|      :| ...||..:.:|....      |: |.|.:.||.|::..| 
Human    23 LVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILG------GVPAPERKWPWQVSVHYA- 80

  Fly   129 TSSYVAGGALIAPHVVITAR---QRTENMTASQLVVR------AG---EWDFSTKTEQLPSVDVP 181
             ..:|.||:::..:.|::|.   .|.:|:....:.|.      ||   :|             ..
Human    81 -GLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGLVNLRVAGNHTQW-------------YE 131

  Fly   182 IRSIVRHPGFNLENG-ANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDP 245
            :..::.||.:.:.:. ..:||||.|:..:..|..:.|:|:.:...|...:.|..||||..|....
Human   132 VNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATPEVNLTSANCWATGWGLVSKQGE 196

  Fly   246 SYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIKDN 309
            : .:.|:::.||::....|    .|.||:...:...::|||. ...|..||||.|.||.|...  
Human   197 T-SDELQEMQLPLILEPWC----HLLYGHMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFN-- 254

  Fly   310 PQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGPYLN 374
             :.:...|||::|..|..|..|.||.:|:...:||.......|.|  .:..|..||.|  ||.|:
Human   255 -RSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWICDNIEITPTP--AQPAPALSPAL--GPTLS 314

  Fly   375  374
            Human   315  314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 63/244 (26%)
Tryp_SPc 113..344 CDD:238113 63/244 (26%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.