DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG31954

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:232 Identity:69/232 - (29%)
Similarity:120/232 - (51%) Gaps:25/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP 181
            :.|..|:|   :|||::.||::|:...::||...|...||.:|.||.|..:|: ::.||    :.
  Fly    61 DAPHQVSL---QTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFA-RSGQL----LR 117

  Fly   182 IRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP-SAPKNFDFSRCIFTGWG--KNSFD 243
            ::.||:|..||..|...:.:|:.|...:........:.:| |..|..|...|..:|||  :|..:
  Fly   118 VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLE 182

  Fly   244 DPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIK 307
            ...:   |:::.:|:|.:..|.::.:.|.|    :...::|||. |.|||:|:||.|.|:.    
  Fly   183 SREW---LRQVEVPLVNQELCSEKYKQYGG----VTERMICAGFLEGGKDACQGDSGGPMV---- 236

  Fly   308 DNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
              .:..||.|:|::|..|..|..|.||:.|:...:||
  Fly   237 --SESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/230 (29%)
Tryp_SPc 113..344 CDD:238113 67/230 (29%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 67/230 (29%)
Tryp_SPc 51..274 CDD:238113 69/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.