DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG11911

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:245 Identity:61/245 - (24%)
Similarity:110/245 - (44%) Gaps:32/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVAL-LDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAG-----EWDFSTK 171
            |:....|::|:| .:....|::.||.||....::||...........::  ||     |.|..|:
  Fly    43 AEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSII--AGLHTRAEVDELTQ 105

  Fly   172 TEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTG 236
            ..|:....|       |..:....|..::||:.:..|...:..:.|..:||..:..:....:: |
  Fly   106 QRQVDFGRV-------HEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLY-G 162

  Fly   237 WGKNSFDDPSYM----NVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEG 296
            ||:    ..||:    ..|:.::..::....|:::|    .....:..|.:|:.. :..|.:|.|
  Fly   163 WGQ----PKSYIFSGAKTLQTVTTQILNYEECKEEL----PESAPIAESNICSSSLQQSKSACNG 219

  Fly   297 DGGSPLACAIKDNPQRYELAGIVNFG-VDCGLPGVPAVYTNVANVIEWIT 345
            |.|.||.....:.|.  ||.|||::| :.|||..:|::||.|:..|:|||
  Fly   220 DSGGPLVVEFTNAPS--ELIGIVSWGYIPCGLANMPSIYTKVSAYIDWIT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 58/242 (24%)
Tryp_SPc 113..344 CDD:238113 58/242 (24%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 61/245 (25%)
Tryp_SPc 37..266 CDD:214473 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.