DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG14227

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:285 Identity:69/285 - (24%)
Similarity:118/285 - (41%) Gaps:47/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ITDPQCGF---VNSKGVTFSFREEDTGLAQEAEVPWMVALL---DARTSSYVAGGALIAPHVVIT 146
            :.|.:||.   .|:|...:::.:..|.:...   ||:|:::   .|:.|     |:||....|:|
  Fly    26 LLDAECGRSLPTNAKLTWWNYFDSSTDIQAN---PWIVSVIVNGKAKCS-----GSLINHRFVLT 82

  Fly   147 ARQRTENMTASQLVVRAGEWD-------FSTKTEQLPSVDVPIRSIVRHPGF-NLENGANNVALV 203
            |   ...:....:.|..|::|       .|:......:..|.|...:.|.|| .::....::.|:
  Fly    83 A---AHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLL 144

  Fly   204 FLRRSLTSSRHINPICM----PSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTC 264
            .::.::..|..:.|||:    |.|.    ..|...|.||..:.|..|...|||......:.|..|
  Fly   145 RMQHAVQYSDFVRPICLLINEPVAA----IDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELC 205

  Fly   265 EQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAI-KDNPQRYELAGIVNFGVD--CG 326
            ..:.:.      ::|.|.:|...|. ..:|:||.|.|.:..| .....|....||:.||:.  .|
  Fly   206 TLKFQQ------QVDESQICVHTET-SHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAG 263

  Fly   327 LPGVPAVYTNVANVIEWITLTTVNM 351
            |    :|.|||...::||....||:
  Fly   264 L----SVCTNVTFYMDWIWDALVNL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 59/248 (24%)
Tryp_SPc 113..344 CDD:238113 59/248 (24%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 59/242 (24%)
Tryp_SPc 57..277 CDD:238113 59/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.