DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP010243

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_554157.3 Gene:AgaP_AGAP010243 / 3292148 VectorBaseID:AGAP010243 Length:275 Species:Anopheles gambiae


Alignment Length:229 Identity:66/229 - (28%)
Similarity:110/229 - (48%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIR 183
            |:.|::.:  .:.::.||::|....|:||....::..|:.:.||.|. .|..|...:..||    
Mosquito    59 PYQVSVRE--LNEHICGGSIITNRWVLTAGHCVDDTIAAYMNVRVGS-AFYAKGGTIHPVD---- 116

  Fly   184 SIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR-CIFTGWGKNSFDDPSY 247
            |:..||.....:...:.||:.|:.::..|....||.:.....|....| |:.||||:...::.|:
Mosquito   117 SVTTHPDHVPYSWLADFALLQLKHAIVFSTIAQPIALAFRLDNALSDRECVVTGWGRTLNEEESF 181

  Fly   248 MNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG--EPGKDSCEGDGGSPLACAIKDNP 310
             :.|:.:.:|:|.|..|.   ..|.|   ::|.:::|||.  :.||.||..|.|.||.|....  
Mosquito   182 -DKLRAVQIPLVSRVLCN---ATYEG---KIDQTMICAGDFVDGGKGSCAYDSGGPLVCGDMQ-- 237

  Fly   311 QRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
                 .|||::|..|.:||.|.||::|.....||
Mosquito   238 -----VGIVSWGKGCAMPGYPDVYSSVLYARAWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/227 (28%)
Tryp_SPc 113..344 CDD:238113 64/227 (28%)
AgaP_AGAP010243XP_554157.3 Tryp_SPc 47..269 CDD:238113 66/229 (29%)
Tryp_SPc 47..266 CDD:214473 64/227 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.