DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP009006

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_552907.3 Gene:AgaP_AGAP009006 / 3291875 VectorBaseID:AGAP009006 Length:401 Species:Anopheles gambiae


Alignment Length:360 Identity:82/360 - (22%)
Similarity:134/360 - (37%) Gaps:86/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QCVPRHMCK-------VKIEFRMAMTY------RNLG-CV--------------------STA-- 68
            :||.||:.:       |..|.::|:.|      |..| ||                    .||  
Mosquito    73 ECVIRHISRRELDTSLVAPELKLALDYICEASDREAGVCVHIDHCSHRALAKDVVKVCTNETAPI 137

  Fly    69 ICCPKNLIIKEPRL-IINEPITDPQ------CGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLD 126
            :|||.|..|....| ::.|..|:.|      ..||..:|.....  ||........:.|.|   :
Mosquito   138 VCCPVNSFIATAHLPLLTECETNYQRFRKKYADFVGDRGTAQPL--EDGAHPHSVMIGWKV---N 197

  Fly   127 ARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGF 191
            ...:::...|.||..:.|:|. ....||      |..||.:.:...:....: :.::..:|:|.:
Mosquito   198 KTATAWHCTGTLINLNTVLTT-AGCANM------VSVGETNVARIYDGAAQI-IRVKETIRYPSY 254

  Fly   192 NLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISL 256
            |.:...|::|::.|...:..:.:..|.|:..     |.:|..:.| .:..||..|    |.....
Mosquito   255 NAKTHDNDIAVLKLESDVLVNENAIPACLWR-----DLNRTPYYG-QEVHFDGQS----LTARDK 309

  Fly   257 PVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNP----QRYE--- 314
            .||..|.|:     .:.:..||.|..:|.    .:.....||.....|..|.||    ||..   
Mosquito   310 NVVHNRDCQ-----LFTSHTELTNDQLCW----QEFRLRPDGADAPNCGRKGNPFITLQRTNNIY 365

  Fly   315 ---LAGIVNFGVDCGLPGVPAVYTNVANVIEWITL 346
               |.|:.::...|. .|.|.|.|.:::.|.||:|
Mosquito   366 LPYLVGLYSYDRQCA-GGEPIVATRISSYINWISL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 51/240 (21%)
Tryp_SPc 113..344 CDD:238113 51/240 (21%)
AgaP_AGAP009006XP_552907.3 Tryp_SPc <1..64 CDD:304450
Tryp_SPc 184..398 CDD:304450 52/244 (21%)
Tryp_SPc 184..397 CDD:214473 51/243 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.