DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP008996

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_552892.3 Gene:AgaP_AGAP008996 / 3291870 VectorBaseID:AGAP008996 Length:249 Species:Anopheles gambiae


Alignment Length:229 Identity:71/229 - (31%)
Similarity:124/229 - (54%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYV--AGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP 181
            ||.::|...|||:|:  .|.||:..:..|||....:|:..|.|::|.||:|.:.:.|.....:..
Mosquito    19 PWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDLALEEEPYGYQERR 83

  Fly   182 IRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPS 246
            ::.:..||.|:......::||:.....:....:|.|:|:|...:||.......||||: .::|..
Mosquito    84 VQIVASHPQFDPRTFEYDLALLRFYEPVVFQPNIIPVCVPENDENFIGRTAFVTGWGR-LYEDGP 147

  Fly   247 YMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEP-GKDSCEGDGGSPLACAIKDNP 310
            ..:||:::::||::...||...| ..|....:.:..:|||.:. |.||||||.|.|:  .|:...
Mosquito   148 LPSVLQEVTVPVIENNICETMYR-SAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPM--VIQRTD 209

  Fly   311 QRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            :|:.|||::::|:.|..|..|.|||.::...:||
Mosquito   210 KRFLLAGVISWGIGCAEPNQPGVYTRISEFRDWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/227 (30%)
Tryp_SPc 113..344 CDD:238113 69/227 (30%)
AgaP_AGAP008996XP_552892.3 Tryp_SPc 6..243 CDD:214473 69/227 (30%)
Tryp_SPc 7..246 CDD:238113 71/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.