DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:232 Identity:52/232 - (22%)
Similarity:101/232 - (43%) Gaps:19/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPS 177
            |...:.||||:|.:: .:.::.||.|::...|:::........|:..:..||....:|..  :|.
Mosquito    30 AVAGDAPWMVSLRNS-INQHLCGGTLLSNRFVLSSANCLSGRLATATMAVAGSRFLNTAA--IPY 91

  Fly   178 VDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSF 242
            ..:   .|:.||.||:....::|||.........::.:.|:.:.:..........:| |||.:..
Mosquito    92 YGI---QIITHPNFNVNTLEHDVALFQTALQFILTQSVQPLPLSADVIGVGVRARVF-GWGASQA 152

  Fly   243 DDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIK 307
            :..: .|.|:.:::..:....|...|.   ...:.:..|.:|.....|:..|.||.|..|   :.
Mosquito   153 NGGN-TNALQFLNVNTLSNDDCANFLG---AEGWRIGPSSLCTLTREGQGICGGDEGGAL---VL 210

  Fly   308 DNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ||   |.: |:.::|:.|. .|.|.|:..::.|..||
Mosquito   211 DN---YAI-GVASWGIPCA-TGRPDVFVRISAVRSWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 50/230 (22%)
Tryp_SPc 113..344 CDD:238113 50/230 (22%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 50/230 (22%)
Tryp_SPc 24..242 CDD:238113 50/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.