DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP004567

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_313871.5 Gene:AgaP_AGAP004567 / 3291034 VectorBaseID:AGAP004567 Length:321 Species:Anopheles gambiae


Alignment Length:289 Identity:86/289 - (29%)
Similarity:134/289 - (46%) Gaps:33/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CVSTAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDAR 128
            |.....|.....:||.|...:.  :|  .||    :|.| |.|......|...|.||:|.||  .
Mosquito    51 CCMYTRCMLLGHVIKVPTYFLY--LT--ACG----RGKT-SSRIVGGDAADVKEYPWIVMLL--Y 104

  Fly   129 TSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVR---HPG 190
            ..::..||:||....::||.....:.|..||:         .|...:...::..|:||:   |..
Mosquito   105 RGAFYCGGSLINDRYIVTAAHCVLSFTPQQLL---------AKLYDVEHGEMVTRAIVKLYGHER 160

  Fly   191 FNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKIS 255
            |:|:...|::|||.|::.:.:.....|||:|.|.::|........||||  ..:.|....|:|..
Mosquito   161 FSLDTFNNDIALVKLQQPVEAGGSFIPICLPVAGRSFAGQNGTVIGWGK--LANGSLSQGLQKAI 223

  Fly   256 LPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIV 319
            :|::....|.:.  .|..:  .:.::::||| .|.|:|:|:||.|.||  .:.|:..| ||.|||
Mosquito   224 VPIISNMQCRKS--SYRAS--RITDNMLCAGYTEGGRDACQGDSGGPL--NVGDSNFR-ELVGIV 281

  Fly   320 NFGVDCGLPGVPAVYTNVANVIEWITLTT 348
            ::|..|..|..|.|||.|...:.||...|
Mosquito   282 SWGEGCARPNYPGVYTRVTRYLNWIKSNT 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/234 (30%)
Tryp_SPc 113..344 CDD:238113 71/234 (30%)
AgaP_AGAP004567XP_313871.5 Tryp_SPc 84..306 CDD:214473 72/241 (30%)
Tryp_SPc 85..309 CDD:238113 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.