DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP007262

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_564960.3 Gene:AgaP_AGAP007262 / 3290331 VectorBaseID:AGAP007262 Length:316 Species:Anopheles gambiae


Alignment Length:246 Identity:62/246 - (25%)
Similarity:112/246 - (45%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSY-VAGGALIAPHVVITARQ----------RTENMTASQLVVRAGEW 166
            |:..:.|:.||||....|.. :.|.::|....|:||..          ...|.||   ::.|...
Mosquito    72 ARPGQFPYQVALLGQFNSGVGLCGASIITQRYVLTAAHCVYIGVDASTPVANGTA---ILGAHNR 133

  Fly   167 DFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR 231
            .....::|  .:......::.|||::|.:..|::|:|.|...:..:..|.||.:|.......|:.
Mosquito   134 MIEEPSQQ--RITFSASGVIGHPGYDLFDVRNDIAVVRLDEPILYTDRIQPIRLPGRSDTRTFAG 196

  Fly   232 CIFT--GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSC 294
            .:.|  |:|..|..:|...:||..:..||:....|.   ..:.|.::.::...:|..|:.|:.:|
Mosquito   197 LMGTVSGYGVYSTANPGLSDVLNYVLNPVITNADCR---AAWSGFEWLIEPQNVCQSGDGGRSAC 258

  Fly   295 EGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLP-GVPAVYTNVANVIEWI 344
            ..|.|.||  .::||.:..:: |:|:||...|.. |:|.|:..|...::||
Mosquito   259 NSDSGGPL--TVQDNGESLQV-GVVSFGSAGGCDNGIPTVFARVTYYLDWI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 60/244 (25%)
Tryp_SPc 113..344 CDD:238113 60/244 (25%)
AgaP_AGAP007262XP_564960.3 Tryp_SPc 65..306 CDD:214473 60/244 (25%)
Tryp_SPc 66..309 CDD:238113 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.