DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP006676

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_316713.4 Gene:AgaP_AGAP006676 / 3290209 VectorBaseID:AGAP006676 Length:268 Species:Anopheles gambiae


Alignment Length:246 Identity:58/246 - (23%)
Similarity:106/246 - (43%) Gaps:32/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LAQEAEVPWMVALLDARTSSYVAG---GALIAPHVVITARQRTENMTASQLV---VRAGEWDFST 170
            :|...:.|:.|.|: .|.:..:.|   |:|::.:.::||.:....:.::..|   :|..|     
Mosquito    30 IATAGQFPYTVGLI-TRINILLTGQCAGSLVSANFILTAARCVSGIQSAVAVLGGLRINE----- 88

  Fly   171 KTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPS---APKNFDFSRC 232
             ..:..:|.:.:...:.||.:..|....:||||.|...:..|.:|.|:.:|:   ....|:..:.
Mosquito    89 -PNEPGAVRITVTDFIIHPQYEAEPDVFDVALVRLPLPVPFSDNIRPVRLPNLRQVEATFNGQQA 152

  Fly   233 IFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGD 297
            ..||||:.. :..:...||:.....|:....|    ||....:..||.. :|..| .....|:||
Mosquito   153 TVTGWGRFG-EGTANSEVLRFGRSQVISTLAC----RLSLPTNTILDQH-VCTDG-ANSSPCQGD 210

  Fly   298 GGSPLACAIKDNPQRYELAGIVNF----GVDCGLPGVPAVYTNVANVIEWI 344
            .|:||  .|.|........|:.:|    |.:.|.   .||:|.:::.:.||
Mosquito   211 VGAPL--TIVDADGITTQIGVFSFISILGCESGR---AAVHTRMSSYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 56/243 (23%)
Tryp_SPc 113..344 CDD:238113 56/243 (23%)
AgaP_AGAP006676XP_316713.4 Tryp_SPc 24..256 CDD:214473 56/244 (23%)
Tryp_SPc 25..256 CDD:238113 56/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.